PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C007727P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family ZF-HD
Protein Properties Length: 279aa    MW: 30757.7 Da    PI: 7.6647
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C007727P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer99.91.9e-3150105359
     ZF-HD_dimer   3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRrevee 59 
                     k +Y+eClkNhA+ +Ggha+DGCgEf+++ g+egt +alkCaAC+CHRnFHR+e+++
  MELO3C007727P1  50 KPKYRECLKNHAVGIGGHALDGCGEFLAA-GAEGTLDALKCAACNCHRNFHRKETDN 105
                     679*************************9.999*********************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257742.0E-2229105IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047701.4E-2852103IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015662.3E-2852102IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152327.04953102IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Gene3DG3DSA:1.10.10.601.1E-30172244IPR009057Homeodomain-like
SuperFamilySSF466898.97E-19172244IPR009057Homeodomain-like
TIGRFAMsTIGR015653.4E-24185241IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 279 aa     Download sequence    Send to blast
MDFEDQEEHE EEEMDMAAAS YDDSLPNSGT RLKIPTTADQ IISSSPGQRK PKYRECLKNH  60
AVGIGGHALD GCGEFLAAGA EGTLDALKCA ACNCHRNFHR KETDNNLNPA VGVGLGIGEP  120
FLLPHPGQFS PYYRTPAGYL HVAPHHRPLA LPSTSGGGGT HSREEQEDMS NPSGGGGGGS  180
SSFGKKRFRT KFTQEQKDRM LGLAETLGWR IQKHDEAVVQ QFCNDTGVKR HVLKVWMHNN  240
KHTLGNMWAL LNLQRFFPSI FLFFPPIPLS FYLLKKKN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh7_A6e-261862431875ZF-HD homeobox family protein
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818750.0LN681875.1 Cucumis melo genomic scaffold, anchoredscaffold00007.
GenBankLN7132620.0LN713262.1 Cucumis melo genomic chromosome, chr_8.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008440565.10.0PREDICTED: zinc-finger homeodomain protein 1-like
SwissprotQ6YXH55e-80ZHD1_ORYSJ; Zinc-finger homeodomain protein 1
SwissprotA2Z2595e-80ZHD1_ORYSI; Zinc-finger homeodomain protein 1
TrEMBLA0A0A0KGP30.0A0A0A0KGP3_CUCSA; Zinc finger homeodomain protein 1
STRINGVIT_00s0199g00250.t011e-105(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20634253
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24660.15e-63homeobox protein 22